Pay in installments of $90.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
COL6A3 His Tag Protein, HumanProduct Specification Species Human Synonyms COL6A3, collagen, type VI, alpha 3 Accession P12111 Amino Acid Sequence Thr3101 Thr3177, with N terminal 8*His HHHHHHHHTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT Expression System HEK293 Molecular Weight 11 13kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution
Product Specification
| Species | Human |
| Synonyms | COL6A3, collagen, type VI, alpha 3 |
| Accession | P12111 |
| Amino Acid Sequence | Thr3101-Thr3177, with N-terminal 8*His HHHHHHHHTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPVLAKPGVISVMGT |
| Expression System | HEK293 |
| Molecular Weight | 11-13kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Kim, Gloria B et al. (2022) Quantitative immunopeptidomics reveals a tumor stroma-specific target for T cell therapy. Science translational medicine. 14: 660. |
Background
Mutations in the genes COL6A1, COL6A2, and COL6A3, coding for three α chains of collagen type VI, underlie a spectrum of myopathies. The COL6A3 gene provides instructions for making one component of type VI collagen, which is a flexible protein found in the space that surrounds cells. The COL6A3 protein is a component of type VI collagen and is present in connective tissues throughout the body, but exon 6 is only expressed in stromal cells in the tumor microenvironment. Collagen is found in the extracellular matrix, which is necessary for cell stability and growth. Research suggests that type VI collagen links basement membranes, which are thin, sheet-like structures that are part of the extracellular matrix, to nearby cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 19 reviews
Sort
Product Reviews
★★★★★ 5
Great new beginning
Format: Kindle
I didn't really care for the Krakoan era as a whole, and knowing how comics, especially the X-Men, go through cycles every few years, knew it wouldn't last.
I'm especially glad to see the somewhat bland logos go and the classic ones return.
I like this line up so far, especially the inclusion of the Juggernaut. I remember reading the comics years ago when he first switched sides, and was.disappointed when he went back to being bad.
I haven't read the concluding chapters of the Krakoan era yet, so seeing a "classic" version of the Beast is a little surprising since the last time I saw him he had turned into an evil piece of %#@+.
The story by Jed MacKay was interesting and entertaining, as I knew it would be. I've always enjoyed Ryan Stegman's art. Looking forward to more of this series and the other X-Men books, especially Uncanny X-Men.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 30, 2024
★★★★★ 3
More of the same
Format: Kindle
I haven’t read X-Men comics in years, but decided to dive back in as a supplement to all the Marvel Cinematic buzz. The plot seems like standard X-Men fare. The weakness of the comic medium, particularly for characters like the X-Men, is the holding pattern of the status quo that the characters are constantly suck in. I’m not sure if this series will deliver a clever twist on it yet. The dynamic they are setting up with the downtrodden Sentinel manufacturing town is interesting, as is the implicit aspiration of the X-Men to replenish the land itself.
I am enjoying the team composition and the gorgeous art. They decided to crucify Wolverine again and it looked cool as ever. Juggernaut’s costume, too, is incredibly drawn.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2024
★★★★★ 5
Great new beginning
Format: Kindle
This story hits all the right notes for a 1st issue, with new mysteries and new characters. Love the team, with stalwarts like Beast, Wolverine, and Cyclops. Looking forward to more!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 31, 2024
★★★★★ 5
Krakoa is gone, but a new era begins!
Format: Kindle
I was pleased to see this was not a reboot but a continuation in the aftermath of the Fall of the House of X. MacKay certainly started off this new run on the right foot, ending with intrigue and introducing potentially new big bads. Excited to throw my money at Marvel in the months to come.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 10, 2024
★★★★★ 2
FROM THE ASHES… ?
Format: Kindle
As a longtime comics enthusiast and certainly a faithful fan of Marvel’s mightiest man, there’s something left to be desired of the 70s into 80s era of X-MEN that marked its genius. Chris Claremont is legendary in his scope and his indelible style that helps make the X-Men something of flesh and bone that jumped off the page.
Unfortunately that hasn’t been properly passed, and the torch hasn’t landed in the hands of creatives who can really capture that spirit. It’s hard to recognize any of these characters, or connect with their situation. This group of X-Men and their mission (whatever it is) are uninteresting, uninspired and lacking any authenticity.
Interestingly written, the art has some textured, but the story isn’t engaging.
I really wanted to like and support this “all-new, all-different” direction, but I can’t. This is not for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 16, 2024
recommand products
NGK Spark Plugs Iridium IX for Tata Indigo XL (BKR6EIX)
1760.00
RK BB 525 GXW XW-Ring Blue Chain
4864.00
BMC Air Filter for Jaguar F-Type Coupe 3.0 V6 2013+ (FB810/20)
8499.50
NGK Spark Plugs Iridium IX for Honda Civic 1.5 / 1.8i / 2.0i (IZFR6K-11S)
2580.00
Funko Pop! Collectible - Mecha Sonic
17.00