Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 24 - Jul 29
For Your Every Summer RSVP, with Code: SUMMER15
Description
PCSK9 His Tag Protein, RatProduct Specification Species Rat Synonyms PCSK9, FH3, PC9, FHCL3 Accession P59996 Amino Acid Sequence Gln31 Gln691, with C terminal 10*His
Product Specification
| Species | Rat |
| Synonyms | PCSK9, FH3, PC9, FHCL3 |
| Accession | P59996 |
| Amino Acid Sequence | Gln31-Gln691, with C-terminal 10*His QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEEATVAAAICCRSRPSAKASWVHQGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-70kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Jaén R I. et al. (2022) Functional Crosstalk between PCSK9 Internalization and Pro-Inflammatory Activation in Human Macrophages: Role of Reactive Oxygen Species Release. Int J Mol Sci. 23(16): 9114. |
Background
PCSK9 (proprotein convertase subtilisin-kexin type 9) is a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. PCSK9 undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Atherosclerosis is a cardiovascular disease caused mainly by dyslipidemia and is characterized by the formation of an atheroma plaque and chronic inflammation. Proprotein convertase subtilisin/kexin type 9 (PCSK9) is a protease that induces the degradation of the LDL receptor (LDLR), which contributes to increased levels of LDL cholesterol and the progress of atherosclerosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.5 ★★★★★
Based on 8 reviews
Sort
Product Reviews
★★★★★ 5
Comfortable feel
Easy connect. Works smoothly. Feels comfortable in the hand. Price is great. Good choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
★★★★★ 5
It works and is well priced.
This mouse works as well as much higher-priced brand-name items. It fits well in the hand. The durability is very good. Considering the price compared to other brand names, this is a very good value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
★★★★★ 4
Solid Everyday Mouse with a Few Comfort Trade-Offs
I’ve been using this Amazon Basics 2.4 GHz wireless optical mouse as a simple, no-frills option, and overall it does exactly what it’s supposed to do. Setup was instant with the USB nano receiver, tracking is accurate, and the wireless connection has been reliable with no dropouts or lag during daily use. It’s lightweight and works well for general browsing and office tasks.
Where it falls a bit short for me is ergonomics. Compared to my Logitech mouse, this one doesn’t feel quite as natural or contoured in the hand during longer sessions. It’s by no means uncomfortable, just not as refined in terms of hand fit. That said, for the price and simplicity, it’s a dependable mouse that gets the job done. A solid choice if you want something basic and reliable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2026
★★★★★ 5
Works Perfect, No Installation Needed, Perfect Size, and Wonderful Price!
Several months ago when the keys on my laptop mouse pad started to go out, I was really irritated because I have gotten so used to using the mouse pad that I was worried that I wouldn't be able to work as efficiently using a wireless mouse. I knew that it would only be a few days before the keys got to the point that I wouldn't be able to use them and started looking on Amazon for a wireless mouse that I might possibly be able to stand using on a daily basis. I spotted the AmazonBasics Wireless Mouse and thought that it wouldn't be that great because it was way cheaper than most of the other wireless ones that I could find. I went ahead and placed my order because I needed something and thought that if it didn't work that well, I wouldn't be out of that much money. When it arrived, I was happy to see that it was a tad bit smaller than other ones that I have used with desktops in the past since I have small hands. I opened the package, popped in some batteries, plugged the nano receiver into my USB slot, and it was working instantly. I thought that it would take some time to install ( I did not read much on it when I purchased it honestly, I just needed one quick!), but was SO happy to see that it needed nothing to be installed. I have been using this wireless mouse for about a year and half now and I have recommended it to SO many people who were looking for one. I work at home on my laptop 7 days a week and anywhere between 12 - 18 hours a day. I only have to change the batteries about once every two months (sometimes it will go a little longer and sometimes a little bit less - not sure on why though). This mouse has worked flawlessly since the day of purchase and I was SO wrong to think that because it was cheaper than the others that it wouldn't work as well. There has never been a time where it disconnected from the computer or that there was any issue using it. A few times when it has needed the batteries changed and I wait a few days, there is a tiny lag - but that is all my fault. The AmazonBasics Wireless Mouse has a little red indicator light that lets you know when the batteries are getting low and need to be changed. I like that feature so that I'm always aware of when they need to be changed. Since I travel a lot, this mouse is great because it doesn't take up a lot of space in the laptop bag. I also never have to worry about losing the nano receiver because once you remove the little door to the battery area, there is actually a space that the nano receiver clicks into making it perfect for travel. If you are in the market for a great wireless mouse, I would recommend the AmazonBasics Wireless Mouse because it has been through over a year of my all day, everyday use and still works just like the day that I purchased it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2015
★★★★★ 5
Click
Great, cheap, practical, simple to use, what more can you ask for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026