Pay in installments of $42.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human Reg4, His tagProduct Specification Species Human Synonyms Gastrointestinal secretory protein, REG like protein, Regenerating islet derived protein IV (Reg IV), GISP, RELP Accession Q9BYZ8 Amino Acid Sequence Protein sequence (Q9BYZ8, Asp23 Pro158, with C 10*His) DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted
Product Specification
| Species | Human |
| Synonyms | Gastrointestinal secretory protein, REG-like protein, Regenerating islet-derived protein IV (Reg IV), GISP, RELP |
| Accession | Q9BYZ8 |
| Amino Acid Sequence | Protein sequence (Q9BYZ8, Asp23-Pro158, with C-10*His) DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRPGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 17.6 kDa Observed MW: 56-72 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Regenerating islet-derived protein 4 (Reg4) also called Reg IV or RELP (Reg-like protein), is a secreted glycoprotein belonging to the regenerating gene (Reg) family within the calcium (C‑type) dependent lectin superfamily. Reg4 expression is induced by growth factors and promotes phosphorylation and activation of the EGF R. Reg4 is preferentially expressed in the gastrointestinal (GI) tract. Reg4 expression is increased within or near inflammation, dysplasia and metaplasia of the GI epithelium, such as inflammatory bowel disease (Crohn’s disease and ulcerative colitis), colon adenocarcinoma, pancreatic cancer, gastric adenocarcinoma, and is often increased in the plasma in these conditions. It is especially associated with neuroendocrine tumors in the GI, as well as some prostate, parathyroid, skin Merkel cell and lung small-cell carcinomas. Tumor cells expressing Reg4 are generally more mitogenic, metastatic and resistant to apoptosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy