Pay in installments of $26.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Cyclophilin A His Tag Protein, HumanProduct Specification Species Human Antigen Cyclophilin A Synonyms Peptidyl prolyl cis trans isomerase A, PPIase A, Cyclosporin A binding protein, Rotamase A Accession P62937 Amino Acid Sequence Met1 Glu165, with C terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH Expression System E. coli Molecular Weight 20kDa
Product Specification
| Species | Human |
| Antigen | Cyclophilin A |
| Synonyms | Peptidyl-prolyl cis-trans isomerase A, PPIase A, Cyclosporin A-binding protein, Rotamase A |
| Accession | P62937 |
| Amino Acid Sequence | Met1-Glu165, with C-terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 20kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris，250mM NaCl, pH 6.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Cell Death Dis. 2013 Oct 31;4(10):e888. |
Background
Cyclophilin A (CyPA, 18 kDa) is a ubiquitously distributed protein belonging to the immunophilin family. Cyclophilin A (CyPA) is a peptidyl-prolyl cis-trans isomerase that exists in the intracellular and secretory forms and has multiple functions. Intracellular CypA takes part in folding, transport, and assembly of proteins; regulates cell proliferation; is a ligand for cyclosporine A (CsA), mediating its immune-suppressive activity; mediates signal transduction from a T cell receptor, and controls the balance of T helpers 1 and 2, inhibiting activity of T helpers 2.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy