SKU: 79684843909

Human TNF-β Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TNF-β Protein, His TagProduct Specification Species Human Synonyms Lymphotoxin alpha, LT alpha, TNF beta, Tumor necrosis factor ligand superfamily member 1, LTA, TNFB, TNFSF1 Accession P01374 Amino Acid Sequence Protein sequence (P01374, Leu35 Leu205, with C His Tag) LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms Lymphotoxin-alpha, LT-alpha, TNF-beta, Tumor necrosis factor ligand superfamily member 1, LTA, TNFB, TNFSF1
Accession P01374
Amino Acid Sequence

Protein sequence (P01374, Leu35-Leu205, with C-His Tag) LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Expression System HEK293
Molecular Weight Predicted MW: 20.3 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNF-beta, also known as Lymphotoxin-alpha (LTα), is a cytokine belonging to the tumor necrosis factor (TNF) superfamily. Its primary function involves the development and organization of secondary lymphoid organs, such as lymph nodes and spleen, during embryogenesis. In adulthood, TNF-beta is a key mediator in the maintenance of the lymphoid architecture and the initiation of inflammatory responses against pathogens. It exists in two forms: a soluble homotrimer that signals through TNF receptors 1 and 2, and a membrane-bound heterotrimer with LTβ, which signals through the LTβ receptor. Dysregulation of TNF-beta is implicated in autoimmune and chronic inflammatory diseases, making it a significant therapeutic target.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 79684843909

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
JCMIV63
New York, US
★★★★★ 5
Cushioned, comfortable, stylish and a rubber sole!
Size: 10, Color: Brown
These shoes check multiple boxes for me, comfortable, cushioned, rubber sole and stylish. As my feet grow old and worn out, I'm on a constant search for comfortable, cushioned shoes that are suitable for work and dressier occasions. I have tried many expensive shoes that look great but either lack cushioning, arch support and or comfort. One of the nice things is these shoes have a rubber sole, where most cushioned shoes have the foam soles which are great, but they tend to lack grip particularly when its damp/wet. They have average arch support, but the insole is removable and I put my own cushioned arch support. Love these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
D
Verified Purchase
DDD Projects
Bozeman, US
★★★★★ 5
OG Style
I am a big fan of Bruno Marc shoes. Over the years they have provided comfortable and affordable boots and shoes. These blue, tan and white soled dress sneakers are no exception. They have a nice finished look that makes them both causal and dressy. The lightweight style is still warm enough for colder mid-west winters. The box of the toes is wide and comfortable. The insole is well padded and a pleasure to wear. This is another fine pair of shoes to add to my collection and yours.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
P
Verified Purchase
Premium Reviews
Omaha, US
★★★★★ 5
Must buy: Comfort + Casual + Well Made / Ventilated
Size: 8, Color: Brown
Just buy it! I have put in roughly 15,000 steps in this shoes in 10 days and I can't believe how comfortable they are after this much rough use in short amount of time. I highly recommend this shoes to anyone looking for comfort in casual style.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
W
Verified Purchase
William W.
Battle Creek, US
★★★★★ 5
WIDE Dress Shoes With SUPPORT
Size: 10.5, Color: Brown
I've seen dress shoes and worn dress shoes before, but these are simply the best dress shoes I've ever worn my entire life. 99% of dress shoes have the same problem, they have the thinnest little soles that offer no support. BRUNO MARC HAS SOLVED THE PROBLEM. These dress shoes not only support wide feet like mine who historically have had and still have little support in the market, but Bruno Marc has wide options that fit perfectly, and the support with the thick foam sole is so needed and awesome. I had a pleasant surprise putting these things on and there being some tactile grip enhancers inside the shoe so you can feel the shoes better and get a little tickle / massage while you're at it. These things are dripping with style, easy to wear, and while they might look firm on the outside, on the inside the shoe just has such a nice flexibility and foamy feel, the top where the top of your feet feel the roof of the shoe, it has such perfect ooey gooey support I can't believe it. The outside sole also has this neat tactile feel. The durability looks good and feels good for now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 28, 2025
D
Verified Purchase
Dan Che
Charlottesville, US
★★★★★ 5
Perfect Blend of Comfort and Style
Size: 9, Color: Brown, Size: 9, Color: Brown
I recently purchased size 9 of these shoes, and they exceeded my expectations in every way! Here’s what I love about them: 1. Comfort: The moment I put them on, I noticed how soft and supportive they felt. The cushioning provides all-day comfort, making them perfect for long walks, workdays, or running errands. 2. Fit: The sizing is spot-on! I ordered my usual size, and they fit perfectly with no need to size up or down. There’s enough room for my toes to move without feeling too loose or tight. 3. Style: These shoes look even better in person. The design is sleek and versatile, making them easy to pair with both casual and semi-formal outfits. I’ve received several compliments already! 4. Durability: I put it on the day of purchase. After wearing them daily for a couple of days, they still look brand new. The stitching and material seem high-quality and built to last. 5. Value for Money: For the price, these shoes deliver exceptional value. You’re getting premium comfort and style without breaking the bank. Final Thoughts: If you’re looking for shoes that offer comfort, style, and durability, I highly recommend giving these a try. I’ll definitely be considering another pair in a different color soon! To conclude, I’m very happy for this purchase. Will definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2025

recommand products